İçerik

  • Giriş, Yaratılışçıların “abiyogenezin imkansızlığı” hesaplamalarındaki sorun nedir?
  • İlkel protoplazmik globül
  • Yaşam döngüsü miti
  • Başlangıç seviyesindekiler için sözcük tanımlama ve makromoleküler demet
  • Uzayda aramalar, veya samanlıkta iğne aramak?
  • Sonuçlar
  • Referanslar
  • Linkler

Giriş

Sıklıkla birileri  “şans eseri herhangi bir enzimin oluşması imkansızdır, bu yüzden abiyogenez de imkansızdır” ifadesi ile gelirler. Genellikle astrofizikçi Fred Hoyle’un etkileyici hesaplamasından bahsederler, veya yaşamın istatistiksel olarak imkansız olduğunu kanıtlamak için “Borel Kanunu” denen şeyi gösterirler. Bu insanlar, Fred de dahil olmak üzere, bir veya birden fazla hata yapmaktadırlar.

———————————————————————————————————————

Sözlük

Asil transferaz: Peptidleri sentezleyen bir enzim veya ribozim

Ligaz: Bir monomeri bir polimere ekleyen bir ezim veya ribozim, ya da iki kısa polimeri birleştiren enzim.

Monomer: Bir polimerin herhangi bir alt ünitesi. Bir amino asit bir peptidin veya proteinin monomeridir, bir nükleotid azılnükleotidin veya polinükleotidin monomeridir.

Nükleotid: Adenin,Guanin,Sitozin ve Urasil.Bunlar azılnükleotidleri veya RNA gibi polinükleotidleri meydana getiren monomerlerdir.

Azılnükleotid: Nükleotidin alt ünitelerinin kısa bir polimeridir.

Polimeraz: Monomerleri tanzim ederek polimer oluşturan bir enzim veya ribozimdir. Örneğin, RNA polimeraz tekli nükloetidlerden RNA meydana getirir.

Ribozim: RNA tarafından yapılan biyolojik bir katalizördür.

 Öz Kopyalayıcı: Küçük alt ünitelerinden aynı veya aynına yakın kopyalar yapabilen bir molekül. En az dört öz kopyalayıcı bilinmektedir.

———————————————————————————————————————

Yaratılışçıların ” bu o kadar imkansız ki”  hesaplamaları

  1. “Modern” bir proteinin oluşma olasılığını veya hatta bütün “modern” proteinleri ile tam bir bakterinin rastgele olaylarla oluşma olasılığını hesaplarlar. Abiyogenez teorisi tam olarak bu değildir.
  2. Yaşam için gerekli her bir protein için belli sayıda ; birbirini takip eden proteinler olduğunu farz ederler.
  3. Anlık denemeler yerine birbirini takip eden denemelerin olasılığını hesaplarlar.
  4. Onlar olasılık hesaplamaları ile ne demek istendiğini anlamazlar.
  5.  Birçok sayıda işlevsel enzimin/ribozimin rastlantısal olarak birbirini takip ettiğini hafife alırlar.

Bu belirgin hataları incelemeyi deneyeceğim, ve “abiyogenezin mümkün olması”‘nın neden imkansız olduğunu tüm yönleri ile hesaplayacağım.

İlkel protoplazmik globül

İDDİA: 300 amino asidin bir proteini (karboksipeptidaz gibi bir enzim diyelim) meydana getirme olasılığı rastlantısal olarak 1/20 300 veya 2.04 x 10390 da birdir, hayrete düşürecek kadar imkansızdır.  Bu 400 veya daha fazla sayıda benzer enzimin bir araya gelerek bir biçim kazanması olasıklarının hesaplanması ile daha da inanılmaz bir hal alır. Bu en ufak canlı organizmaların oluşmasının bile tamamen imkansız olduğunu gösterir. Fakat, bu tamamen yanlıştır.

İlk olarak biyolojik monomerlerin polimerleri meydana getirmesi kimya ve biyokimya kanunlarının bir fonksiyonudur ve bunlar rastlantısal olarak kararlaştırılmamaktadır.

İkinci olarak, önerme başından sonuna kadar yanlıştır; çünkü modern abiyogenez teorilerine göre ilk “yaşamsal şeyler” daha basit olacaklardır, hatta bir protobakteri veya preprotobakteri (Oparin’in  protobiont olarak adlandırdığı ve Woese’in progenot olarak adlandırdığı) bile değil, ama bir veya birkaç basit molekülün , büyük olasılıkla 30-40 alt ünitenin bir araya gelmesinden oluşacaklardır. Bu basit moleküller sonra yavaşça kendini kopyalayan daha kooperatif sistemlere , ve en son olarak basit organizmalara evrilmişlerdir  [2, 5, 10, 15, 28]. Hipotetik protobiont ile modern bakterinin karşılaştırıldığı bir ilüstrasyon altta verilmiştir.

İlk “yaşayan şeyler”; Ghadiri grubunda bulunan kendini kopyalayan moleküle benzer bir kendini kopyalayan molekül olabilir [7, 17], veya kendini kopyalayan heksanükleotid [10] olabilir , ya da kendini kopyalayan RNA polimeraz da olması da mümkündür.

Bir başka görüşe göre ilk kendini kopyalayanlar; kendilerini katalitik bir döngüde kopyalayan katalizör gruplarıydılar, ya protein enzimleriydiler ya da RNA ribozimleriydiler [3, 5, 15, 26, 28]. SunY üç alt ünitesi buna bir örnektir [24].Bu katalitik döngüler küçük bir havuz veya gölde az miktarda bulunabilirdi, ya da bir kil veya killi topraklarda bulunan lipid malzemelerde absorbe edilmiş kompleks bir katalitik olabilird. Rastlantısal peptid veya polinükleotidlerin (aşağıda gösterilen)birbirini takip eden katalitik peptid gruplarını meydana getirmesi çok da sıradışı değildir.

Bu iki model birbirinden ayrışık değillerdir. Ghadiri peptidi mutasyona uğrayabilir ve katalitik döngüler meydana getirebilir [9].

İlk kendini kopyalayanların basit moleküller olması, veya kompleks yada küçük moleküller olması önemsizdir; bu model  Hoyle’un “ormanda 747 üreten bir tornado” söylemi gibi değildir. Bunu baltalamak için , burada  yaratılışçılar tarafından eleştirilen teori ile asıl abiyogenez teorisinin basit bir karşılaştırması yer almaktadır.

Gerçek teorinin birkaç sayıda küçük adımdan meydana geldiğini ve bazı adımları (özellikle hiperdöngü ile protobiont aşaması arasındaki)basit olması için dışarda bıraktığımı dikkate alın. Her adım organizasyondaki ve karmaşıklıktaki artışla ilintilidir. Ve kimyasallar yavaşça organizma tepesini yavaşça tırmanıyorlar, büyük atlamalar yerine [4, 10, 15, 28].

Yaratılışçıların modern organizmaların aniden ortaya çıktığı iddiası kesin değildir. İlk modern abiyogenez formülasyonu, 20’lerdeki Oparin/Haldane hipotezinden, basit proteinlerin/proteoinoidlerin  yavaşça hücreleri geliştirmesidir. 1850’lerdeki teoriler bile aniden oluşum teorileri değildi. En yakın bulabildiğim Lamarck’ın 1803! yılındaki orijinal iddialarıdır! [8].

Yaratılışçıların 150 yaşında tarihi geçmiş bir teoriyi eleştirdikleri bilinirken, ve hiç bir modern evrimci biyolog tarafından dikkate alınmazken, neden uzatalım? Çünkü bu yanlış  “yalanlamalarda” yer alan istatistiklerde ve biyokimyada temel bazı problemler var.

“Yaşam Döngüsü Miti”

Başka bir iddia da sıklıkla duyulan, canlıların yaşaması için gerekli ;amino asit sırası değiştirilemeyen 400 proteinden oluşan “yaşam döngüsü” iddiasıdır.

Fakat, bu kesinlikle anlamsızdır. 400 protein iddiasının  Mikrobakteri Genetalium ‘un (modern canlılar arasında bilinen en küçük genom) protein kodlayan genomundan geldiği gözükmektedir. Fakat, genome araştırmaları göstermektedir ki bu sayı 256 proteinden oluşan bir gene kadar azaltılabilir. Şunu tekrar dikkate alın ki bu modern bir organizmadır. İlk protobiont/progenot daha da küçük olmalıdırlar [4], ve kimyasal sistemlerin öncesindedirler [3, 10, 11, 15]..

Proteinlerin birbirlerinin takip sıralarının değiştirilemez  olmalarının kanıt olarak sunulması, yine saçmadır. Birçok proteinde herhangi bir amino asit tarafından yeri doldurulabilen belirli bölgeler vardır, ve değişim sorumlusu bölgeler (yüklü amino asitlerin  başka yüklü amino asitler ile veya nötral aminoasitlerin başka nötral aminoasitler iler,yada hidrofobik amino asitlerin başka amino asitler ile)vardır.Bazı eşit işleve sahip moleküllerin %30-50 si kadar amino asitleri farklıdır. Aslında yapısal olarak aynı olmayan bakteri proteinlerini maya proteinleri ile değiştirmek mümkündür, ve kurtçuk proteinlerini insan proteinleri ile değiştirmek mümkündür, ve organizmalar mutluca yaşamaya devam ederler.

Yaşam döngüsüne dair sunulan iddialar bir mittir.

Başlangıç Seviyesindekiler için Yazı Tura ve  Makromoleküler İçtima

Hadi yaratılışçıların oyununu oynayalım ve bir peptidi rastlantısal olarak amino asitlerden bir araya getirmeye bakalım. Bu kesinlikle peptidlerin erken dönem Dünya’sında oluşması için bir yol değildir, ama açıklayıcı olacaktır.

Ghadiri grubundan yukarda bahsedilmiş olan kendini kopyalayan peptidi örnek olarak alacağım [7].  Başka örnekleri de kullanabilirdim, mesela hekzanükleotidler gibi, ama yaratılışçıların iddiaları ile  tarihsel örtüşüm için peptid ideal. Bu peptid ,  32 amino asit uzunluğunda   ve RMKQLEEKVYELLSKVACLEYEVARLKKVGE sekansında , kendini 16 amino asitlik alt üniteler şeklinde kopyalayan bir peptid ligaz ve enzim. Abiyotik peptid sentezini elde etmek için aynı zamanda uygun büyüklük ve birleşimde. Aslında bu bir kendini kopyalayandır ve eklenmiş olması ironiktir.

Bunu rastgele denemelerle başarılı bir şekilde üretme olasılığı (1/20) 32 veya 4.29 x1040 da birdir. Bu yaratılışçıların 2.04×10390 da bir olasılıklı “şans eseri karboksipeptidaz elde etme” seneryosuna göre çok, ama çok  daha yüksek bir olasılıktır, ama hala absürd durmaktadır.

Bununlar birlikte, bu olasılık tahminlerinin başka bir tarafı daha vardır, ve çoğumuzun istatistiklerden anlamamasına dayanır. Ne zaman biri bize bir olayın olma olasılığının milyonda bir olduğunu söylese, birçoğumuz olayın gerçekleşmesi için bir milyon deneme yapılması gerektiğini düşünür ama bu yanlıştır.

Burada sizin de yapabileceğiniz bir deney var: bir bozuk para alın , ve 4 kere yazı tura atın, sonuçları yazın , ve bir daha yazın. Bir seferde 4 kez tura gelmesi için kaç kez atmanız gerektiğini düşünüyorsunuz?

Şimdi bir seride 4 kez tura gelmesi olasılığı (1/2)4 veya 16 da 1 olasılıktadır. Peki 4 kez tura gelmesi için 16 kez yazı tura atmamız gerekli midir? Hayır, başarılı deneylerde ben 11,10,6,16,1,5 ve 3. denemelerde TTTT elde ettim. 16 da bir olasılık (veya milyonda bir veya 1040 da 1) verilmiş denemelerde bir olayın gerçekleşme ihtimalini verir, ama seride gerçekleşme sırasını söylemez. İlk denemenizde TTTT atabilirsiniz (ben yaptım). 4.29 X 1040 da 1 olasılıkta bile, kendini kopyalayıcı şaşırtıcı derecede erken oluşabilir. Ama daha fazlası var.

4.29 x 1040 hala küçümsenemeyecek, uğraşması zor bir rakam. Yukarıdaki argümanlar ile bile (ilk denemenizde elde edebilirsiniz) birçok insan “kesinlikle rastlantısal olarak kendini kopyalayıcının oluşma süresinin dünyanın oluşumundan daha fazla zaman alacağını” söyleyeceklerdir. Gerçekte böyle değildir , eğer gerçekten sadece bir protein/DNA/proto-kopyalayıcı her deneyde ele alınmışsa, yukarıda anlattığımız deneyler ardışık denemelerdi. Gerçekte  okyanuslarda, veya katalitik zemin ve iklim sağlayan binlerce kilometrelik sahillerde milyarlarca molekül blok oluşumu denemesi gerçekleşmekteydi [2,15].

Bozuk paralarla olan örneğimize geri dönelim. 4 kez yazı tura atmanın 1 dakika sürdüğünü  söylersek; TTTT elde etmek ortalama 8 dakika sürecektir. Ve şimdi 16 arkadaşla, her birinde bir bozuk para olacak şekilde, 4 er  kez eş zamanlı yazı tura atın, TTTT elde etme olasılığı şimdi 1 dakika oldu. Şimdi 6 kez yazı tura atmayı deneyin,bu (1/2)6 veya 64’te bir olasılığa sahiptir. Bu ortalama yarım saat sürecektir, fakat 64 kişi ile deneyin, ve bir dakika içinde yapın. Eğer milyarda bir olasılıklı bir sekans için yazı tura atmak gerekirse , sadece  Çin’in nüfusunun sizin için yazı tura atmasını sağlayın, kısa sürede sekansı yakalarsınız.

Bu durumda eğer prebiyotik dünyamızda aynı anda oluşan 1 milyar peptid varsa, bu bizim kopyalayıcımızı oluşturmak için gereken zamanı inanılmaz derecede azaltıyor.

Tamam, sayıya tekrar bakıyorsunuz, 4.29×1040 da 1 şans, bu büyük bir rakam ve milyar tane başlatıcı molekül olsa da , acaba ilk yarım milyar yılda ilk kopyalayıcıyı ilk yarım milyar yılda rastlantısal olarak elde edebilir miyiz?

Evet, 1 kilogram arginin amino asidi 2.85×1024 molekül içerir (bu yaklaşık milyar kere milyardan fazladır); argininin bir tonu 2.85×1027 moleküle sahiptir. Eğer her amino asitten bir taşıyıcı ile alıp orta büyüklükte bir gölü doldurursanız,  kopyalayıcıyı birkaç on yılda elde edebilirsiniz; 55 amino asit uzunluğunda proteinleri 1-2 haftada yaptığınızı varsayarak [14,16].

Peki bu prebiyotik dünyada nasıl şekillendi? Erken dönem dünyasında okyanuslar 1x 1024 litrelik hacme sahiplerdi. 1×10-6 M  amino asit konsantrasyonu (kısmen seyreltilmiş  çorba, bkz. Chyba ve Sagan 1992, bu durumda 1x 1050 potansiyel başlangıç zinciri vardır, ve bu durumda uygun miktarda yeterli miktarda peptid ligaz (yaklaşık 1×1031) bir yıldan daha kısa bir sürede oluşabilir; tek başına milyonlarca yıl sürecekken. İlkel kendini kopyalayanlar daha sık gerçekleşmiş olabilir, 4.29x 1040 da 1 şans verilmiş olsa bile ( ve hatırlayın, kopyalayıcımız ilk denemede sentezlenebilirdi)

Farz edin ki sekansı sağlamak 1 hafta sürsün  [14,16]. Bu durumda Ghadiri ligazı bir haftada oluşturulabilirdi ve herhangi bir sitokrom C sekansı bir milyon yıldan biraz fazla bir sürede sağlanabilirdi ( tüm olası peptid sekansları arasında, büyük bir işlevsel protein çeşidi oranıyla).

Ghadiri ligazı örnek olarak kullanmama rağmen, yukarıda da belirttiğim gibi  aynı hesaplamalar SunY kendini kopyalayıcısı veya Eklanda RNA polimerazı içinde yapılabilir. Bunu okuyucu için bir egzersiz olması için bırakıyorum, fakat genel sonuç ( bir sürü işi kısa zamanda yapabilirsiniz) oligonükleotidler içinde aynıdır.

Uzayda aramak  veya samanlıkta iğne aramak

Küçük bir enzim elde etmenin yaratılışçıların (ve Fred Hoyle’un) iddia ettiği kadar da inanılmaz ve kafa karıştırıcı bir olay olmadığını gösterdim .Başka bir yanlış anlaşılan konu da birçok insan  ezimlerin/ribozimlerin sayılarının, serbest bırakılan ribozomal RNA polimerazlarının veya herhangi bir kendini kopyalayıcı formunun,  çok farklı dizilimlere sahip olduklarını ve tek bir enzim/ribozim oluşumunun , serbest koşullarda, rastlantısal olarak eklenen amino asit/nükleotidlerle oluşturulması ihtimalinin çok az olduğunu düşünürler.

Fakat, Ekland tarafından yapılan bir analiz 220 nükleotidlik bir RNA’nın sekans aralığının , 2.5×10112 sekansılarının inanılmaz bir şekilde ligazlarda da etkili olduğunu göstermektedir  [12].  Daha önceden yapısal olduğu düşünülen bir bileşik için fena değil. 1×1024 litrelik ilkel okyanusumuza  dönersek, ve 1×10-7 M nükleotid yoğunluğuna sahip olduğunu farz edersek [23],  bu durumda ancak 1x 1049 potansiyel nükleotid zinciri vardır, ki bu da yeterli sayıda RNA ligazın (yaklaşık 1 x 1034)  1 yılda elde edilmesini sağlar, serbest durumda bir milyon yıl sürecekken. RNA polimerazlarının potansiyel sayısı çok yüksektir, yaklaşık 1020 sekansta bir RNA polimeraz vardır[12].  Benzer yaklaşımlara ribozomal asil tranferazları ( yaklaşık her 1015 sekansta bir) ve ribozomal nükleotid sentezi içinde başvurulur [1, 6, 13].

Benzer olarak, 1x 1030 olası 100 birim proteinde,3.8×1061 tanesinde sitokrom C mevcuttur. Bir sürü fonksiyonel enzime peptid/nükleotid aramasında rastlanır ve görünen odur ki işlevsel enzimler erken dünyanın ilkel prebiyotik çorbasında oluşturulabilir.

Daha gerçekçi ( kafa bulandırıcı olsa da ) rakamlarla , amino asitlerin  “yaşam destekleyici” sistemlere (protein enzimleri olabilir, RNA  sistemleri olabilir, veya RNA ribozim-protein enzimi evrilmesi olabilir [11, 25])  gözükecek ki karamsar orijinal monomer  konsantrasyon  rakamlarıylan ve sentez zamanlarıyla bile mümkündür.

Sonuçlar

Yaratılışçıların olasılık hesaplamaları aksiyomu en baştan yanlıştır ve yanlış teoriyi hedefler. Ayrıca , bu tez çoğu zaman yanlış istatistikler ve biyolojik hatalarla desteklenmektedir.

Şu an için , yaşamın mümkünatı hakkında bir fikrimiz olmadığından, sanal olarak herhangi bir anlamlı olasılık hesaplaması yapmamız , yaşamın ilk iki adımı dışında (monomerlerin polimerlere dönüşmesi,katalitik polimerlerin oluşması) mümkün değildir. Kendinin kopyalayan polimerlerin dönüşümü, olasılık hesapları uygundur ve Kauffman geçiş modellerindeki katalitik  kapanmada haklıdır, fakat bu gerçek kimya bilgisi gerektirir ve doğrulamak için daha detaylı modellemeler gerekir. Hipersiklet-protobiont geçişi için, burada yer alan olasılıklar teorik konseptlere dayanmaktadır ve geliştirilmektedir, ve bilinmemektedir.

Fakat, son olarak yaşamın mümkünlüğü kimya ve biyokimyaya bağlıdır ve biz hala çalışmaktayız, yazı tura atmıyoruz.

Bir Cevap Yazın

Aşağıya bilgilerinizi girin veya oturum açmak için bir simgeye tıklayın:

WordPress.com Logosu

WordPress.com hesabınızı kullanarak yorum yapıyorsunuz. Log Out / Değiştir )

Twitter resmi

Twitter hesabınızı kullanarak yorum yapıyorsunuz. Log Out / Değiştir )

Facebook fotoğrafı

Facebook hesabınızı kullanarak yorum yapıyorsunuz. Log Out / Değiştir )

Google+ fotoğrafı

Google+ hesabınızı kullanarak yorum yapıyorsunuz. Log Out / Değiştir )

Connecting to %s